PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G115700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 283aa    MW: 31939.4 Da    PI: 4.3588
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G115700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-2067120356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k++++t+eq++ Le+ F+ ++++  e+++eLAkklgL+ rqV +WFqNrRa++k
  Aqcoe3G115700.1.p  67 KKRRLTAEQVHLLEKSFAAENKLEPEQKTELAKKLGLQPRQVAIWFQNRRARWK 120
                        56789************************************************9 PP

2HD-ZIP_I/II129.81.1e-4166157192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrl++eqv+lLE+sF +e+kLepe+K+ela++Lglqprqva+WFqnrRAR+ktkqlE+dy++Lk++yd+l ++ +++ ke+e++++e+ 
  Aqcoe3G115700.1.p  66 EKKRRLTAEQVHLLEKSFAAENKLEPEQKTELAKKLGLQPRQVAIWFQNRRARWKTKQLERDYDVLKASYDSLLSNYDTIVKENEKIKSEVV 157
                        69*************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.81562122IPR001356Homeobox domain
SMARTSM003894.3E-2065126IPR001356Homeobox domain
CDDcd000862.12E-1967123No hitNo description
SuperFamilySSF466895.99E-2067132IPR009057Homeodomain-like
PfamPF000468.3E-1867120IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.1E-2268129IPR009057Homeodomain-like
PRINTSPR000311.4E-693102IPR000047Helix-turn-helix motif
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
PRINTSPR000311.4E-6102118IPR000047Helix-turn-helix motif
PfamPF021831.5E-16122163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MDTGGRYLFD GSCHGSMFVL GNGSDSIFRG SRSLLNMEEN PNKKRAFFSY AEEFMEEEFY  60
DEQLPEKKRR LTAEQVHLLE KSFAAENKLE PEQKTELAKK LGLQPRQVAI WFQNRRARWK  120
TKQLERDYDV LKASYDSLLS NYDTIVKENE KIKSEVVSLA EQLKAKDVTS MGVELCQKMD  180
QLHPTKDVDI VAVHLCVKAE DYLSSGSGGS AVVDEDGPQL VDSGDSYFPN EDYQIYMGQV  240
DGVQSEEDDG SDDGQSYFSN VFAGAVQQQE VTEPSLGWWG WS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114122RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251293.11e-123PREDICTED: homeobox-leucine zipper protein HAT5-like
RefseqXP_010251294.11e-123PREDICTED: homeobox-leucine zipper protein HAT5-like
SwissprotQ022832e-85HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A061EJ861e-122A0A061EJ86_THECC; Homeobox-leucine zipper protein HAT5
STRINGVIT_14s0066g01440.t011e-115(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-80homeobox 1